DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss52

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_082801.2 Gene:Prss52 / 73382 MGIID:1920632 Length:321 Species:Mus musculus


Alignment Length:322 Identity:89/322 - (27%)
Similarity:129/322 - (40%) Gaps:69/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIILMFQLLHSGCSQFLDPACGIRTQSRT--------------AYRIINGHTAKYNSSPWMVFL- 62
            |::|...||..|....|...||.|..||:              |..|:.|..|.....||.|.: 
Mouse    10 GLLLPLVLLLFGACSSLAWVCGRRMSSRSQQLNNASAIVEGKPASAIVGGKPANILEFPWHVGIM 74

  Fly    63 -HSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDA 124
             |.:   .:||||::.:..||:|:|||  :.|..|....|      :|:.:.....:::   ||.
Mouse    75 NHGS---HLCGGSILNEWWVLSASHCFDQLNNSKLEIIHG------TEDLSTKGIKYQK---VDK 127

  Fly   125 GFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV-------VWDHRWRHYLDKIDLLTATGWG 182
            .|.|..:|.....||||:|.|...:....|..|||.       .|.:.|           .||||
Mouse   128 LFLHPKFDDWLLDNDIALLLLKSPLNLSVNRIPICTSEISDIQAWRNCW-----------VTGWG 181

  Fly   183 KTQMES---DSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD--SNLCNGDSGGPLGAVIT 242
            .|....   ....||.:.:.....|.|. :|...:..|..|||..|  .:.|.||||   ||::.
Mouse   182 ITNTSEKGVQPTILQAVKVDLYRWDWCG-YILSLLTKNMLCAGTQDPGKDACQGDSG---GALVC 242

  Fly   243 HK--NTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFILRVWR------MYGKGQTLPI 293
            :|  ||..:.||||.|: ...|.|.:   |:|.|..:..:|.:...      ||.:....|:
Mouse   243 NKKRNTAIWYQVGIVSW-GMGCGKKNLPGVYTKVSHYVRWISKQTAKAGRPYMYEQNSACPL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/254 (29%)
Tryp_SPc 45..278 CDD:238113 73/253 (29%)
Prss52NP_082801.2 Tryp_SPc 56..285 CDD:238113 74/256 (29%)
Tryp_SPc 56..282 CDD:214473 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.