DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss44

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:288 Identity:80/288 - (27%)
Similarity:119/288 - (41%) Gaps:70/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVA 96
            |||.||.     ||:.|..|.....||.|.| ......:||||||:...|:|||||...:.....
Mouse   104 ACGHRTA-----RIVGGRPAPARKWPWQVSL-QVHKQHICGGSLISKWWVITAAHCVYGHLDYAV 162

  Fly    97 RLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP-------------NTHANDIAILRLSKS 148
            .:|:                     .|...|..:..|             .|..:|||::.|:..
Mouse   163 FMGD---------------------ADLWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFP 206

  Fly   149 VVYRDNIRPICVVWDHRWRHYLDKIDLLT-ATGWGKT-QMESDSDALQTLDIRRQPPDVCAKFIG 211
            |.|..||:|:|:    ..:.:|.:...|. .|||||. :....|..||.:::.....:.|.:.: 
Mouse   207 VNYSVNIQPVCI----PEKSFLVQPGTLCWVTGWGKVLEQGRSSRILQEIELNIIRHEKCNQIL- 266

  Fly   212 QTIAGNQF--------CAGN-WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK--- 264
            :.|.||.|        |..| ...:.|.|||||||  |.....|  :|||||.|: ...|.:   
Mouse   267 KDIMGNIFTLVQEGGVCGYNEKGGDACQGDSGGPL--VCEFNKT--WVQVGIVSW-GLGCGRIGY 326

  Fly   265 ASVFTDVLSHAEFILR------VWRMYG 286
            ..|:|:|..:.::|::      .|::.|
Mouse   327 PGVYTEVSYYRDWIIKELSRASCWKLSG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/260 (28%)
Tryp_SPc 45..278 CDD:238113 71/259 (27%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 72/260 (28%)
Tryp_SPc 112..340 CDD:238113 71/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.