DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:315 Identity:93/315 - (29%)
Similarity:141/315 - (44%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TALIGVPTFVGIILMF-QLLHS-GCS-----QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMV 60
            |:.:.:.|..|.:.:: :|.|| .||     .....|||:...|....||:.|.:|...:.||.|
Human   244 TSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQV 308

  Fly    61 FLHSTTDMFVCGGSLITDKLVLTAAHCF---IANQ-HLVARLGEYERTRSEECTGYYCNFREEHM 121
            .|| ..::.|||||:||.:.::|||||.   :.|. |..|..|...::......||        .
Human   309 SLH-VQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGY--------Q 364

  Fly   122 VDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQM 186
            |:....|..||..|..||||:::|.|.:.:.|.::|:|:   ......|....|...:|||.|:.
Human   365 VEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCL---PNPGMMLQPEQLCWISGWGATEE 426

  Fly   187 ESDS----DALQTLDIRRQ-------------PPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSG 234
            :..:    :|.:.|.|..|             |..:||.|:          .||.||  |.||||
Human   427 KGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFL----------QGNVDS--CQGDSG 479

  Fly   235 GPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDVLSHAEFILRVWRMYG 286
            |||   :|.||...:: :|..|: ...|.||   .|:.:|:...::|.|..|..|
Human   480 GPL---VTSKNNIWWL-IGDTSW-GSGCAKAYRPGVYGNVMVFTDWIYRQMRADG 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/257 (30%)
Tryp_SPc 45..278 CDD:238113 76/256 (30%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 10/38 (26%)
Tryp_SPc 292..521 CDD:214473 77/257 (30%)
Tryp_SPc 293..524 CDD:238113 77/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.