DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and ctrb.2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:280 Identity:87/280 - (31%)
Similarity:133/280 - (47%) Gaps:35/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIILMFQLLHS--GCS-QFLDPACGIRTQSRTAY-RIINGHTAKYNSSPWMVFLHSTTDMFVC 71
            ||.|:|...|:.:  ||. ..:.|..       |.| ||:||..|..:|.||.|.|..:|....|
Zfish     3 FVWILLCLALIGTAYGCGVPAIPPVI-------TGYARIVNGEEAVPHSWPWQVSLQDSTGFHFC 60

  Fly    72 GGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTH 136
            |||||.:..|:|||||.:...|.|. |||::|:.:.|..       :...|...|||..::..|.
Zfish    61 GGSLINEWWVVTAAHCNVRTSHRVI-LGEHDRSSNAESI-------QTMTVGKVFKHPNFNMFTI 117

  Fly   137 ANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMES-DSDA-LQTLDIR 199
            .|||.:::|:.......::.|:|:...:  .::...:..:| :|||.|:..: |:.| ||...:.
Zfish   118 NNDILLIKLATPAKINTHVSPVCLAETN--DNFPGGMKCVT-SGWGLTKHNAPDTPALLQQAALP 179

  Fly   200 RQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK 264
            ....:.|.:|.|..|.....|||...::.|.|||||||   :..|:.. :..|||.|:.:..|..
Zfish   180 LLTNEDCKRFWGNKITDLMVCAGASGASSCMGDSGGPL---VCQKDGV-WTLVGIVSWGSSVCSP 240

  Fly   265 AS--VFTDVLSHAEFILRVW 282
            :|  |:..|..     ||.|
Zfish   241 SSPGVYARVTK-----LRAW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/237 (31%)
Tryp_SPc 45..278 CDD:238113 73/236 (31%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 77/243 (32%)
Tryp_SPc 34..259 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.