DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and LOC691670

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001103116.1 Gene:LOC691670 / 691670 RGDID:1597224 Length:248 Species:Rattus norvegicus


Alignment Length:253 Identity:72/253 - (28%)
Similarity:107/253 - (42%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWMVFLHST---TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYER 103
            |..||.||..|.:|.|:|.|:.||   .....|||.||..|.|||||||  ....::..||.:..
  Rat    18 AEEIIGGHEVKSHSRPYMAFIASTDTNRSKNFCGGFLIQYKFVLTAAHC--REISMIVILGAHNI 80

  Fly   104 TRSEECTGYYCNFREEHM--VDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRW 166
            :..|         |.:.:  |:....|..|:|..|.|||.:|:|.:......::|    :.:...
  Rat    81 SAQE---------RTQQIIPVEKAIPHPAYNPMDHTNDIMLLKLKRKAKKTKSVR----ILNLPM 132

  Fly   167 RHYLDKIDLLT-ATGWGKTQMESDS--DALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD--S 226
            ||...|..:|. ..|||...:.:..  ..||..::..|....|...........:.|||:..  .
  Rat   133 RHARLKPGVLCHVAGWGLMSLNATKRPALLQEAELIIQEDHECKNVFRHYSETTEICAGDPKKIQ 197

  Fly   227 NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILRVWRM 284
            ::..|||||||  |..:|      ..|:.||..|....:.:||.|:....:|.|..::
  Rat   198 DIFQGDSGGPL--VCDNK------AYGVVSYGKRRRITSGIFTKVVYFLPWISRKMKL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/243 (28%)
Tryp_SPc 45..278 CDD:238113 69/242 (29%)
LOC691670NP_001103116.1 Tryp_SPc 20..241 CDD:214473 69/243 (28%)
Tryp_SPc 21..244 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.