DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gzmn

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_038949596.1 Gene:Gzmn / 691668 RGDID:1597226 Length:465 Species:Rattus norvegicus


Alignment Length:261 Identity:69/261 - (26%)
Similarity:103/261 - (39%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWMVFLHSTT---DMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYER 103
            |..||.||..|.:|.|:|.|:.|..   ::..|||.|:.|..|||||||  ..:.:...||.:..
  Rat   235 AEEIIGGHEVKPHSYPYMAFIQSVKADGNISYCGGFLVQDYFVLTAAHC--EGESMTVMLGAHNI 297

  Fly   104 TRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRD-------------NI 155
            ...|:.       ::...|:....|..|:...::.||.:|:| ||...|.             .:
  Rat   298 KAKEDT-------QQIISVEKAISHPAYNKVDYSYDIMLLKL-KSKAKRTKAVSTLMLPQSDAQV 354

  Fly   156 RP--ICVVWDHRWRHYLDKIDLLTATGWGKTQMESD--SDALQTLDIRRQPPDVCAKFIGQTIAG 216
            :|  :|.|                 .|||.|.:...  |..|:..::..|....|.|........
  Rat   355 KPGDVCHV-----------------AGWGLTSINGTKVSSCLREAELIIQEDQECEKIFYNYFKT 402

  Fly   217 NQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFIL 279
            .|.|||  |...:...|||||||  |..::      ..|:.:|..:....:.|||.|:....:|.
  Rat   403 IQICAGDPNNVQDASKGDSGGPL--VCDNR------AYGVIAYGKKGEISSGVFTKVVYFLPWIS 459

  Fly   280 R 280
            |
  Rat   460 R 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/255 (26%)
Tryp_SPc 45..278 CDD:238113 66/254 (26%)
GzmnXP_038949596.1 Tryp_SPc 21..>194 CDD:238113
Tryp_SPc 238..461 CDD:238113 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.