DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:280 Identity:74/280 - (26%)
Similarity:109/280 - (38%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAY--RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC------- 87
            |||    .|..|  ||:.|:.:..:..||...| ......:||||:||...::|||||       
Human   206 ACG----HRRGYSSRIVGGNMSLLSQWPWQASL-QFQGYHLCGGSVITPLWIITAAHCVYDLYLP 265

  Fly    88 --FIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVV 150
              :.....||:.|.               |....|:|:....|..|.|....||||:::|:..:.
Human   266 KSWTIQVGLVSLLD---------------NPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLT 315

  Fly   151 YRDNIRPIC------------VVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQP- 202
            :.:.|:|:|            |.|               .:|||.|: :...||...|:....| 
Human   316 FNEMIQPVCLPNSEENFPDGKVCW---------------TSGWGATE-DGAGDASPVLNHAAVPL 364

  Fly   203 --PDVC--AKFIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN 261
              ..:|  ....|..|:.:..|||.....:  |.|||||||  |...:...:.  ||..|: ...
Human   365 ISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPL--VCQERRLWKL--VGATSF-GIG 424

  Fly   262 C---QKASVFTDVLSHAEFI 278
            |   .|..|:|.|.|..::|
Human   425 CAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/264 (26%)
Tryp_SPc 45..278 CDD:238113 67/263 (25%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 3/7 (43%)
Tryp_SPc 216..444 CDD:214473 68/264 (26%)
Tryp_SPc 217..447 CDD:238113 68/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.