DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and zgc:123295

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:302 Identity:88/302 - (29%)
Similarity:129/302 - (42%) Gaps:64/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65
            ::|||    |.||.:|: .:..|.|..   ..|| |....|  :|:.|..|...|.||.|.|.|.
Zfish     3 INTAL----TVVGALLV-NIAGSLCQL---NVCG-RAPLNT--KIVGGQNAGAGSWPWQVSLQSP 56

  Fly    66 T-DMFVCGGSLITDKLVLTAAHCF---IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGF 126
            | ....||||||....||:|||||   |..  ::.:||...::.|..       ::....|....
Zfish    57 TYGGHFCGGSLINKDWVLSAAHCFQDSIGT--IMVKLGLQSQSGSNP-------YQITKTVVQVI 112

  Fly   127 KHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVV------------WDHRWRHYLDKIDLLTAT 179
            .|..|:..::.||||:::|..||.:.|.|.|:|:.            |               .|
Zfish   113 NHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSW---------------VT 162

  Fly   180 GWGKTQMESDS--DALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD---SNLCNGDSGGPLGA 239
            ||||....::.  |.||.::|.......|.:.....|..|..|||..|   .:.|.||||||:  
Zfish   163 GWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPM-- 225

  Fly   240 VITHKNTQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFI 278
              ..:|..:::|.||.|: .|.|.:   ..|:..|..:.::|
Zfish   226 --VSRNGSQWIQSGIVSF-GRGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/257 (29%)
Tryp_SPc 45..278 CDD:238113 74/256 (29%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 74/257 (29%)
Tryp_SPc 36..264 CDD:238113 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.