DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and zgc:123217

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:281 Identity:81/281 - (28%)
Similarity:121/281 - (43%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||:...:.   ||:.|..|...|.||.|.:| ..:..:|||:||..:.|:|||||.|.....|..
Zfish    28 CGVAPLNT---RIVGGTDAPAGSWPWQVSIH-YNNRHICGGTLIHSQWVMTAAHCIINTNINVWT 88

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVDAGFK----HKLYDPNTHANDIAILRLSKSVVYRDNIRPI 158
            |....:|:|       .:....:.|..|.:    |..::.:...|||::::||:.|.:...||||
Zfish    89 LYLGRQTQS-------TSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPI 146

  Fly   159 CVVWDHR--------WRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQP---PDVCA----K 208
            |:..::.        |           |||||....:....|.|||...:.|   ..:|:    .
Zfish   147 CLAANNSIFYNGTSCW-----------ATGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEYES 200

  Fly   209 FIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQKASVFTDVL 272
            ....||.....|||..:...|.||||||...    |....::|.||.|| |:..| ....:.||.
Zfish   201 VNNATITPQMICAGKANKGTCQGDSGGPFQC----KQGSVWIQAGITSYGTSAGC-AVGAYPDVY 260

  Fly   273 SH-AEFILRVW-RMYGKGQTL 291
            |. :||  :.| :|..:|..:
Zfish   261 SRVSEF--QSWIKMNVQGSAI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/254 (30%)
Tryp_SPc 45..278 CDD:238113 74/253 (29%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 76/259 (29%)
Tryp_SPc 37..273 CDD:238113 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.