DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and c1s

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:278 Identity:85/278 - (30%)
Similarity:124/278 - (44%) Gaps:62/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC-------- 87
            |.||:. ||..:.||..|..||....|||:   ..||:.:.|||||:|:.||||||.        
 Frog   424 PVCGVH-QSDKSGRIFGGTRAKPGQFPWMI---QFTDIELGGGSLISDRWVLTAAHVVNKKIFPT 484

  Fly    88 -------FIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA-------N 138
                   |..|.:|.:   :.:|.::::.                ..|.||..|...       |
 Frog   485 MFGGVMKFFPNTNLQS---QEKRLQAKKI----------------IIHPLYQDNEDTEGQSNFDN 530

  Fly   139 DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI--DLLTATGWGKTQMESDSDALQTLDIRRQ 201
            |||:::|:|.|.....|.|||:.     |..|..:  ::.|..|||||:....:..||...|...
 Frog   531 DIALVQLTKKVKLGSCISPICLP-----RRGLAPVVNEVATIAGWGKTEKRESAVNLQFASISLS 590

  Fly   202 PPDVCAKFIGQT--IAGNQFCAGN---WDSNLCNGDSGGPLGAVITH-KNTQRFVQVGIASYTNR 260
            ..|.|.|..|..  ...|..|||:   .||  |||||||||  :.|. :::.:....||.|:..|
 Frog   591 SMDKCKKATGGKGYFTPNMLCAGSDVGKDS--CNGDSGGPL--MFTDPQDSSKMYMAGIVSWGPR 651

  Fly   261 NCQKASVFTDVLSHAEFI 278
            :|....::|.|.::.::|
 Frog   652 DCGTYGLYTKVDNYLDWI 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 79/263 (30%)
Tryp_SPc 45..278 CDD:238113 78/262 (30%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 5/12 (42%)
Tryp_SPc 436..669 CDD:214473 79/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.