DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG17239

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:252 Identity:65/252 - (25%)
Similarity:102/252 - (40%) Gaps:52/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            ||:.|......|.||...: .....|.||.::.::.:|:|||||      |..|..|:...|...
  Fly    23 RIVGGDLITILSVPWQASI-LRLGRFHCGAAIYSEDIVITAAHC------LTDRETEFLSVRVGS 80

  Fly   109 CTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKI 173
            ...::..  :...|.:...|:.|| .:.:||||::||...:               |....:..|
  Fly    81 SFTFFGG--QVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKL---------------RLGSAVSVI 127

  Fly   174 DL----------LTATGWGKTQMESD---SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD 225
            .|          .|.:|||....:.:   |....::||..|  |.|.:..|:.|..:..||....
  Fly   128 PLADTPPASGSPATVSGWGAIGFKKNYPMSILSASVDIVDQ--DQCRRSYGRKITKDMICAAAPG 190

  Fly   226 SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFIL 279
            .:.|:|||||||  |..:|      .|||.|: .:.|   :...|:.:|.....:||
  Fly   191 KDACSGDSGGPL--VSGNK------LVGIVSF-GKECAHPEYPGVYANVAELKPWIL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 63/249 (25%)
Tryp_SPc 45..278 CDD:238113 62/248 (25%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 63/249 (25%)
Tryp_SPc 24..237 CDD:238113 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.