DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG18754

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:295 Identity:85/295 - (28%)
Similarity:117/295 - (39%) Gaps:69/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QLLHS---GCSQFLD-----PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSL 75
            :|||.   .|.:..|     ..||   |:...:|......|:.|..||||.|     ::....||
  Fly    75 ELLHMVYVCCPELGDVLPNKQTCG---QTTPVFRDRGAENAELNEYPWMVLL-----LYENRLSL 131

  Fly    76 ITDKLVLTAAHC----FIANQHLV---ARLGEYER---TRSEECTGYYCNFREEHM--------V 122
            |  :.|||||||    ::....||   .||||...   |....|         .|:        |
  Fly   132 I--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRC---------PHLDVEVGQTTV 185

  Fly   123 DAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDK----IDL-LTATGWG 182
            ..||..   ...|:.||||:|||...|.|...|:|||:         ||.    .|| |..:||.
  Fly   186 HQGFTS---SGGTYRNDIALLRLQFPVRYTKKIQPICL---------LDAEFPLQDLNLQISGWD 238

  Fly   183 KTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNW-DSNLCNGDSGGPLGAVITHKNT 246
            .|:   .|..|.|..::.:.|..|........:.:|.|||.. ..:.|.|.||.|:..::.....
  Fly   239 PTK---SSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVD 300

  Fly   247 QRFVQVGIASYTNRNCQKA---SVFTDVLSHAEFI 278
            :.....|||||..:.|..|   .|:|.:...:|:|
  Fly   301 EFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/260 (29%)
Tryp_SPc 45..278 CDD:238113 75/259 (29%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 3/8 (38%)
Tryp_SPc 108..338 CDD:238113 76/259 (29%)
Tryp_SPc 108..335 CDD:214473 75/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.