DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG34409

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:295 Identity:78/295 - (26%)
Similarity:117/295 - (39%) Gaps:80/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFL-----HSTTDMFVCGGSLITDKLVLTAAHCFIANQ 92
            |||..:|    |::.|..|.....||:..:     .|:...|.|.||||:...::|||||.:   
  Fly   242 CGINVES----RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVV--- 299

  Fly    93 HLVA-------RLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVV 150
            :||:       |||..:....         |..|.::    .|..||...:|||||:||::.:  
  Fly   300 NLVSDLELSHVRLGSQDGATP---------FAIEQVI----VHPNYDQPKYANDIALLRINST-- 349

  Fly   151 YRDNIRPICVVWD---HRWRHYLDKIDLLTATGW--GKTQMESDSD------------------- 191
             .....|||:.::   ......:.:|.:  |.||  |.|:..|..|                   
  Fly   350 -NGTFTPICLPFNGPITLGNRLIGQIGV--AAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTT 411

  Fly   192 ----ALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSN-LCNGDSGGPL---GAVITHKNTQR 248
                |..:|....|.|.|        |..|..||.....| :|.||||||.   |.......:.|
  Fly   412 SCAIAYASLSENFQQPIV--------ITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGR 468

  Fly   249 FVQVGIASYTNRNCQKAS---VFTDVLSHAEFILR 280
            :..:||.::....|...:   |:|.|.|.:::|||
  Fly   469 YTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/280 (25%)
Tryp_SPc 45..278 CDD:238113 70/279 (25%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/280 (25%)
Tryp_SPc 252..501 CDD:238113 70/277 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.