DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG34436

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:285 Identity:80/285 - (28%)
Similarity:126/285 - (44%) Gaps:57/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWM--VFLHSTTDMFVCGGSLIT 77
            :|.:.|.:.|.:|.||..|.  ..||.:..||       .|.|||  |.|.:.|    |.|:||.
  Fly     9 VLSWMLANQGSAQLLDQNCA--EVSRLSNDII-------FSRPWMALVLLPNKT----CSGALIH 60

  Fly    78 DKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAI 142
            ...|:|:|.|....:..:.|||:.. .:.|....|   ..:::.|.:.:.|:.|:.:...:|||:
  Fly    61 KYFVITSASCVFNQERAIVRLGQLS-IKQEHIVSY---SSDDYHVQSAYIHRFYEKSNFEHDIAL 121

  Fly   143 LRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLT-------ATGWGKTQMESDSDALQTLDIRR 200
            |.|...|:|:.:|||||:        :|||.|:.|       ...||..: :....|.:|..|  
  Fly   122 LELQNDVLYKAHIRPICL--------WLDKSDIDTQMFKRYETFRWGIDE-KYILPAAKTSKI-- 175

  Fly   201 QPPDVCAKFIGQTIAGNQFCAGNWDSNLCNG--------DSGGPLGAVITHKNTQRFVQVGIASY 257
                   |.|.|....|.|.....:|::|.|        ::|.||...|.:....|:...||.||
  Fly   176 -------KHISQVKCENAFKLYPQNSHICAGYKNKSKCVETGSPLFKKIRYYTKIRYTLFGIQSY 233

  Fly   258 -TNRNCQKASVFTDVLSHAEFILRV 281
             .:|.|    ::|||..:.::|:.|
  Fly   234 GESRTC----LYTDVTKYIDWIMGV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/251 (27%)
Tryp_SPc 45..278 CDD:238113 69/250 (28%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 67/241 (28%)
Tryp_SPc 40..251 CDD:214473 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.