DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG34171

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:288 Identity:68/288 - (23%)
Similarity:110/288 - (38%) Gaps:91/288 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TAYRIINGHTAKYNS-SPWMV------FLHSTTDMFVCGGSLITDKLVLTAAHC-------FIAN 91
            |..:|.:.|...|:. |.::|      ::|:..|...|.|.::|::.|||:|||       .::.
  Fly    20 TTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSP 84

  Fly    92 QHLVARLGEYERTRSEECTGYY-CNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRD 153
            :.:|..|          |...: ....||.:||..  ..|..|..|.| |||||::| |..|..|
  Fly    85 KRIVVAL----------CASLFKTPESEEFVVDIHNMIIHPYYHRNQH-NDIAIIKL-KRYVKLD 137

  Fly   154 NIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTL----DIRRQ------------- 201
            .             |:|..:.|      |.:.:|..:|. :|:    .:|||             
  Fly   138 G-------------HHLAPVVL------GNSSLEVGNDC-KTIGGIFGVRRQRFGSFHSMLLVNV 182

  Fly   202 ---PPDVCAKFIGQTIAG-----NQFCAGNWDSNLCNGDSGGPL---GAVITHKNTQRFVQVGIA 255
               |.|.|.|.....:|.     :..|..:.:..:|..|.||||   |.:           .|||
  Fly   183 ELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFCDGQL-----------YGIA 236

  Fly   256 SYTNRNCQKAS--VFTDVLSHAEFILRV 281
             ..:.||....  .|:||..:..::.::
  Fly   237 -LGSINCSSPDPVFFSDVSFYNSWVTKI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/280 (24%)
Tryp_SPc 45..278 CDD:238113 67/279 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 65/274 (24%)
Tryp_SPc 38..263 CDD:304450 63/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.