DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG34437

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:267 Identity:68/267 - (25%)
Similarity:117/267 - (43%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLHSGCSQFLDPACGIRTQSRTAYRIIN--GHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVL 82
            |.|.|.:.|||..|            :|  .|...:..:|||.|:.|.|..  |.|:||..:.|:
  Fly    14 LAHQGSAYFLDFEC------------VNHKPHQDVFKETPWMAFIASPTKN--CSGTLINKQYVI 64

  Fly    83 TAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSK 147
            |.|.|..........||.::......      |...:|.|.:.:.||||:..|..:|||:|.|..
  Fly    65 TTASCVFDQSESTVFLGRFDNIPQNR------NRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDD 123

  Fly   148 SVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQ--MESDSDALQTLDIRRQPPDVCAKFI 210
            .|.::.:|:|||:     |...:..::.|.:..||.::  :....:.::.|.|::     |....
  Fly   124 PVTFKMSIQPICI-----WLGEITNLNHLESNRWGLSEKMIFQRINTVKILKIKK-----CRDSF 178

  Fly   211 GQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQKASVFTDVLSH 274
            |.|:..:|.|||..:.|:|. ::|..|...|.:........:||.|| .:..|    ::..:..:
  Fly   179 GITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYNKIAHY 238

  Fly   275 AEFILRV 281
            .::|:.|
  Fly   239 IDWIVGV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 59/238 (25%)
Tryp_SPc 45..278 CDD:238113 59/237 (25%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/225 (25%)
Tryp_SPc 39..242 CDD:304450 57/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.