DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss21

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:325 Identity:87/325 - (26%)
Similarity:131/325 - (40%) Gaps:64/325 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPTFVGIILMFQLLHSGCSQFLDP-------------ACGIRTQSRTAYRIINGHTAKYNSSPWM 59
            ||..|.:......|.|...| :||             .||.||   ...||:.|..|:....||.
Mouse     9 VPLLVVVATAAMALQSTYLQ-VDPEKPELQEPDLLSGPCGHRT---IPSRIVGGDDAELGRWPWQ 69

  Fly    60 VFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ---HLVARLGEYERTRSEECTGYYCNFREEHM 121
            ..|. .....:||.:|:..:.||||||||..:.   ....:.||.....|......|.|   .:.
Mouse    70 GSLR-VWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLWNLQAYSN---RYQ 130

  Fly   122 VDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVV-----WDHR---WRHYLDKIDLLTA 178
            ::..|....|. ..:.||||:|:||..|.|.:.|:|||::     :::|   |           .
Mouse   131 IEDIFLSPKYS-EQYPNDIALLKLSSPVTYNNFIQPICLLNSTYKFENRTDCW-----------V 183

  Fly   179 TGWGKTQMESDS----DALQTLDIRRQPPDVCAKFIGQ-----TIAGNQFCAGNWD--SNLCNGD 232
            ||||... |.:|    :.||.:.:......:|.....:     .|.|:..|||..:  .:.|.||
Mouse   184 TGWGAIG-EDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMVCAGTPEGGKDACFGD 247

  Fly   233 SGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFILRVWRMYGKGQTLPIP 294
            |||||..   .::|. :.|||:.|: ...|   .:..|:|::..|..:|.......|..:..|:|
Mouse   248 SGGPLAC---DQDTV-WYQVGVVSW-GIGCGRPNRPGVYTNISHHYNWIQSTMIRNGLLRPDPVP 307

  Fly   295  294
            Mouse   308  307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/258 (28%)
Tryp_SPc 45..278 CDD:238113 70/257 (27%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 71/258 (28%)
Tryp_SPc 55..294 CDD:238113 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.