DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:303 Identity:82/303 - (27%)
Similarity:115/303 - (37%) Gaps:87/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFI--ANQHLV 95
            || |.......||:.|..|.:.:.||||.|......| ||||||.::.|||||||.:  ....::
Zfish    25 CG-RPNPTLNPRIVGGVNATHGAWPWMVSLQGRYGHF-CGGSLINNQWVLTAAHCIVDQTPSSII 87

  Fly    96 ARLGEYERTRSEECTGYYCNFRE-----EHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNI 155
            ..||::.        .|..:...     .|::    .|..|...|..||||:|:|:.:|.|.|.|
Zfish    88 VYLGKWR--------SYVADVNSISRTIRHII----PHPSYSNITKDNDIALLQLTSTVQYTDYI 140

  Fly   156 RPICVVWD--------HRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQP--------PD 204
            :|||:..:        :.|           ..|||      |...|.|..||.:.        |.
Zfish   141 KPICLADENSNFPRGTNSW-----------VAGWG------DIGVLGTGGIRGRTTVSVPLPHPG 188

  Fly   205 V-------------CAKFIGQTIAGNQFCAGNWDSNLC--NGDSGGPLGAVITHKNTQRFVQVGI 254
            :             |.......|..|..|||.......  :|||||||   :|..:.  :||.|:
Zfish   189 ILQEAELKVYSNADCNNICHGRITPNMICAGTRPGGKATFSGDSGGPL---MTKCSV--WVQAGV 248

  Fly   255 ASYTNRNCQKASVFTDVLSHAEFILRV-----WRMYGKGQTLP 292
            .|: ...|.:.::       .|..:||     |.....|..||
Zfish   249 LSH-GYGCAQPNL-------PEVFIRVSEYKQWITGNVGGNLP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/271 (27%)
Tryp_SPc 45..278 CDD:238113 72/270 (27%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 74/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.