DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:257 Identity:66/257 - (25%)
Similarity:117/257 - (45%) Gaps:55/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEEC 109
            |.:|..||.:|.|:||.|...:.. .|||||||::.|||||||:.....:...:|.::.:.:|. 
Zfish    26 IEDGTEAKPHSRPYMVSLQKNSKN-SCGGSLITEEFVLTAAHCWKKGDVITVVVGAHDLSENET- 88

  Fly   110 TGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLD-KI 173
               |.:|.    |.:...|..:....:.|||.:|:|:|.|...:|:..|.:.     ::..| |.
Zfish    89 ---YDSFE----VTSYIPHPEFSWQNYENDIMLLKLNKKVTLSNNVGLISLP-----KNGEDVKE 141

  Fly   174 D-LLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDS----------- 226
            | :.:..|||:            |.:....||...:.....::|.: |...|:|           
Zfish   142 DAVCSVAGWGR------------LWLNGPRPDRLMEAETVIVSGEE-CKRRWESLFKPSKMFCVY 193

  Fly   227 ---NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR-NCQK---ASVFTDVLSHAEFILRV 281
               ..|.|||||||   :..::.     ||:.|:::| :|..   .:::|.:.::..:|.::
Zfish   194 GHGGTCKGDSGGPL---VCGEHA-----VGVTSFSDRYSCNSRLLPNMYTKISAYLSWIQKI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/252 (26%)
Tryp_SPc 45..278 CDD:238113 65/252 (26%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 66/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.