DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP006673

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001688952.1 Gene:AgaP_AGAP006673 / 5667010 VectorBaseID:AGAP006673 Length:307 Species:Anopheles gambiae


Alignment Length:296 Identity:75/296 - (25%)
Similarity:120/296 - (40%) Gaps:89/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IRTQSRTAYRIINGHTAKYNSSPWMVFLHSTT-DMF--VCGGSLITDKLVLTAAHCFI-----AN 91
            :||..:...||.||..|.....|:...::|.. |.:  :|||:::|...|||||||..     |.
Mosquito    50 LRTVEQPTRRITNGQLATAGQFPYQAVVYSEAGDGYYSLCGGTILTTTYVLTAAHCVTDDFDRAV 114

  Fly    92 QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFK-HKLYDPNTHANDIAILRLSKSVVYRDNI 155
            ...:..||..:||..:. |....:|.     :||.: |..|:..:..||||.:||..:.::..  
Mosquito   115 TGGIVFLGATDRTVFQS-TQQRMSFG-----NAGIRVHPQYNSTSIRNDIATVRLDTAAIFNT-- 171

  Fly   156 RPICVVWDHRWRHYLDKIDLL-------------TATGWGKT--QMESDSDALQTLDIRRQPPDV 205
                         |:..|||.             ||:|:|:|  .:.:.|:.|.           
Mosquito   172 -------------YVKAIDLPALSDARQFGGFEGTASGFGRTADTVPAASNVLM----------- 212

  Fly   206 CAKFIGQTIAGNQFCAGNWDS----------------NLCNGDSGGPLGAVITHKNTQRFVQVGI 254
               |:...:..|..|...|.:                :.|:|||||||..    ::..|.:||||
Mosquito   213 ---FVRNPVMTNAQCNAYWSTAVVQAQNVCLDPYGGRSACHGDSGGPLAV----QDAGRSLQVGI 270

  Fly   255 ASYTNRN-CQ--------KASVFTDVLS-HAEFILR 280
            ||:.:.| |.        :.|.|.|.:| ::.::.|
Mosquito   271 ASFVSANGCTSGAPSVWVRVSYFRDFISQNSNYVFR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/283 (25%)
Tryp_SPc 45..278 CDD:238113 71/282 (25%)
AgaP_AGAP006673XP_001688952.1 Tryp_SPc 59..297 CDD:214473 71/276 (26%)
Tryp_SPc 60..300 CDD:238113 71/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.