DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPC6

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001687772.2 Gene:CLIPC6 / 5666762 VectorBaseID:AGAP000315 Length:361 Species:Anopheles gambiae


Alignment Length:295 Identity:78/295 - (26%)
Similarity:124/295 - (42%) Gaps:66/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GIRTQ----------SRTAYRIINGHTAKYNSSPWMVFLHSTTD-------MFVCGGSLITDKLV 81
            |:|::          ||..:.||:|..|.....|:|..|...||       .:.||.|:|:...:
Mosquito    86 GVRSRLACEQVPKYTSRLTFHIIDGEEASEGEFPFMAALGYPTDDETQQNISYRCGASMISTDFL 150

  Fly    82 LTAAHCFIANQH-LVARLGEYERTRSEECTGYYCNFREEHMVDAG----FKHKLYDPNTHANDIA 141
            ||||||...|.. .||.||.......            .|.|..|    |.|..|..|.:.:|||
Mosquito   151 LTAAHCIPTNDRPTVAILGTNNLAPG------------NHGVLVGLKAFFPHPDYRTNRNYHDIA 203

  Fly   142 ILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD--SDALQTLDIRRQPPD 204
            :::|.:.:....::.|||:..|   ...|.:..:|||.|:|...::.:  |:.|..:::...|..
Mosquito   204 LVQLERRIENEPDVNPICLNDD---LSDLPEDTVLTAEGYGIIDLDRNLRSNQLMKVNLTTVPWQ 265

  Fly   205 VC------------AKFIGQTIAGNQFCAGNWDS-------NLCNGDSGGPLGAVITHKNTQRFV 250
            .|            .:.:.|.|...|:||...::       :.|.|||||||..:    :..::.
Mosquito   266 KCNQTFADSNLLKNNRKLPQGIVATQYCATGRENEEKKVVGDTCQGDSGGPLQIM----DDGKYK 326

  Fly   251 QVGIASYTNRNC--QKASVFTDVLSHAEFILR-VW 282
            .||:.|:.| .|  ...||.|.|.::.::|.. ||
Mosquito   327 LVGVTSFGN-GCGSNTPSVSTRVAAYIDWIESIVW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/268 (26%)
Tryp_SPc 45..278 CDD:238113 71/267 (27%)
CLIPC6XP_001687772.2 CLIP 31..77 CDD:288855
Tryp_SPc 106..355 CDD:214473 71/268 (26%)
Tryp_SPc 107..358 CDD:238113 72/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.