DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and KLK10

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:271 Identity:70/271 - (25%)
Similarity:102/271 - (37%) Gaps:55/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC------ 87
            |||         .||    |......|.||.|.|.:... |.|.|.|:....|||||||      
Human    43 LDP---------EAY----GSPCARGSQPWQVSLFNGLS-FHCAGVLVDQSWVLTAAHCGNKPLW 93

  Fly    88 -FIANQHLVARLGEYER--TRSEECTGYYCNFREEHMVDAGFKHKLYDP----NTHANDIAILRL 145
             .:.:.||:...||..|  |||.....|               |:...|    .|..:|:.:|:|
Human    94 ARVGDDHLLLLQGEQLRRTTRSVVHPKY---------------HQGSGPILPRRTDEHDLMLLKL 143

  Fly   146 SKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKT--QMESDSDALQTLDIRRQPPDVCAK 208
            ::.||....:|.:.:.:     ......|.....|||.|  :....:..|....|....|..|..
Human   144 ARPVVLGPRVRALQLPY-----RCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEV 203

  Fly   209 FIGQTIAGNQFCAG-NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVL 272
            |....:..|..||| :...:.|..||||||   :..:..|..:..|:  |...:.|..:|:|.:.
Human   204 FYPGVVTNNMICAGLDRGQDPCQSDSGGPL---VCDETLQGILSWGV--YPCGSAQHPAVYTQIC 263

  Fly   273 SHAEFILRVWR 283
            .:..:|.:|.|
Human   264 KYMSWINKVIR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/249 (25%)
Tryp_SPc 45..278 CDD:238113 62/248 (25%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 63/248 (25%)
Tryp_SPc 49..269 CDD:214473 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.