DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and PRSS8

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:354 Identity:92/354 - (25%)
Similarity:148/354 - (41%) Gaps:81/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGC-SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSL 75
            |.|:|...||.||. ::..:..||:..|:    ||..|.:|.....||.|.: :...:.||||||
Human    15 VAILLYLGLLRSGTGAEGAEAPCGVAPQA----RITGGSSAVAGQWPWQVSI-TYEGVHVCGGSL 74

  Fly    76 ITDKLVLTAAHCFIANQHLVARLGEYE-RTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAND 139
            ::::.||:|||||.:..|..|    || :..:.:...|..:.:...:.|. ..|..|.......|
Human    75 VSEQWVLSAAHCFPSEHHKEA----YEVKLGAHQLDSYSEDAKVSTLKDI-IPHPSYLQEGSQGD 134

  Fly   140 IAILRLSKSVVYRDNIRPICVVWDHR------------WRHYLDKIDLLTATGWGKTQM----ES 188
            ||:|:||:.:.:...|||||:...:.            |.|....:.|||.....:.::    ..
Human   135 IALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRE 199

  Fly   189 DSDALQTLDIRRQPPD------VCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQ 247
            ..:.|..:|.:.:.|.      |||.::          .|..|:  |.|||||||...:    ..
Human   200 TCNCLYNIDAKPEEPHFVQEDMVCAGYV----------EGGKDA--CQGDSGGPLSCPV----EG 248

  Fly   248 RFVQVGIASYTN----RNCQKASVFTDVLSHAEFILRVWRMYGKGQTLPIPKKPPTTTRPPTWWH 308
            .:...||.|:.:    ||  :..|:|...|:|.:|                :...|..:|     
Human   249 LWYLTGIVSWGDACGARN--RPGVYTLASSYASWI----------------QSKVTELQP----- 290

  Fly   309 TTRIPKQTFQDYDYDTN-HGSHWDWNYSP 336
              |:..|| |:...|:| .|||..::.:|
Human   291 --RVVPQT-QESQPDSNLCGSHLAFSSAP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/260 (27%)
Tryp_SPc 45..278 CDD:238113 68/259 (26%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 69/260 (27%)
Tryp_SPc 45..284 CDD:238113 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.