DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:148 Identity:35/148 - (23%)
Similarity:50/148 - (33%) Gaps:58/148 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HKLYDPNTHANDIAILRLSKSVVYRD--NIRPI------------CVVWDHRWRHYLDKIDLLTA 178
            |.||:.:|:..||.:::||..:....  ::.|:            |.|                 
Zfish    31 HPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPKQNTGLLAGRMCRV----------------- 78

  Fly   179 TGWGKTQMESDSDALQTLDIRRQPPDVCAKF-------IGQTIAGNQFCAGNWDSN--------- 227
            :|||.|   |.|..|..|.:|.....:.:.|       ....|..|..|||:....         
Zfish    79 SGWGST---SHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTGGKDACKNSTQ 140

  Fly   228 --------LCNGDSGGPL 237
                    ||.|||||||
Zfish   141 YLCHLIVYLCQGDSGGPL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 35/148 (24%)
Tryp_SPc 45..278 CDD:238113 35/148 (24%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 35/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.