DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and si:ch1073-280e3.1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_009289626.1 Gene:si:ch1073-280e3.1 / 563828 ZFINID:ZDB-GENE-110411-261 Length:831 Species:Danio rerio


Alignment Length:299 Identity:64/299 - (21%)
Similarity:106/299 - (35%) Gaps:78/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            |||..:.::     :.....| :.||.|.|...|.  .|.||::::.:|||||||.|....:.|.
Zfish   549 CGIAQEEQS-----SADDVSY-TKPWHVDLLWGTK--TCRGSIVSESMVLTAAHCLIKASGVKAT 605

  Fly    98 LGEYERTRSEECTG--------YYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDN 154
            ..:.:.|..   .|        .:..|....:.|...| :.||     .|||::|:.:::.....
Zfish   606 PADIKITHG---AGEVKAVELIVHSQFNVSGLKDKDVK-EFYD-----YDIALIRMKENITISRQ 661

  Fly   155 IRPICV----------------VWDHRWR----------HYLD----KIDLLTATGWGKTQMESD 189
            .||||:                ..|...|          |::.    :.|....:|..:.:....
Zfish   662 TRPICLPCTKSSNRALRMAAGSTCDQHERVLLHLEETPAHFISQGTHRADTHVHSGAKREKCTEK 726

  Fly   190 SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSN----LCNGDSGGPLGAVITHKNTQRFV 250
            :.::...:.|....|:        |.....|.|..|.|    .|.|||||.|..    :...|..
Zfish   727 ARSVLQENSRATLTDI--------ITERFMCTGGSDRNTHHITCKGDSGGALFL----RRRMRHF 779

  Fly   251 QVGIASY-TNRNCQKASVFTDVLSHAE------FILRVW 282
            ||.:.|: :.:.|...:...:.:..|.      |.|..|
Zfish   780 QVAVISWGSKQTCDSRTEHREAVQDASDFHTSVFTLMPW 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 58/282 (21%)
Tryp_SPc 45..278 CDD:238113 58/281 (21%)
si:ch1073-280e3.1XP_009289626.1 CCP 36..93 CDD:153056
CCP 108..156 CDD:214478
CCP 176..231 CDD:153056
CCP 238..291 CDD:153056
vWFA 340..538 CDD:294047
Tryp_SPc 567..822 CDD:238113 60/275 (22%)
Tryp_SPc 567..818 CDD:214473 59/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.