DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and tmprss9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:290 Identity:75/290 - (25%)
Similarity:115/290 - (39%) Gaps:47/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF-IAN--QHL 94
            |...|:...:.||:.|...::...||.|.|. ......||.|::..:.:::||||| :.|  :..
Zfish   220 CSCGTRPVMSNRIVGGENTRHGEFPWQVSLR-LRGRHTCGASIVNSRWLVSAAHCFEVENNPKDW 283

  Fly    95 VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPIC 159
            .|.:|. .:....|...:..|.:...|      ...|||.|..:|:.:|.|...:.:...::|:|
Zfish   284 TALVGA-NQVSGAEAEAFIVNIKSLVM------SPKYDPMTTDSDVTVLELETPLKFSHYVQPVC 341

  Fly   160 VVWDHRWRHYLDKIDLLTATGWG-----KTQMESDSDALQTLDIRRQPPDVCAK---FIGQTIAG 216
            :...   .|..........:|||     .|::.|   .||...::.....||.|   :.| .:..
Zfish   342 IPSS---SHVFTPGQNCIVSGWGALNQYTTEVPS---TLQKAIVKIIDSKVCNKSSVYRG-ALTQ 399

  Fly   217 NQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAE 276
            |..|||.....:  |.|||||||...:.   ..|:...||.|: ...|   .|..|::.|..   
Zfish   400 NMMCAGFLQGKVDSCQGDSGGPLACEVA---AGRYFLAGIVSW-GVGCAQINKPGVYSRVTK--- 457

  Fly   277 FILRVWRM-YGKGQTLPI----PKKPPTTT 301
              ||.|.: |.|  |.|.    |..|..||
Zfish   458 --LRNWIVSYTK--TAPAFQENPTVPSVTT 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/249 (25%)
Tryp_SPc 45..278 CDD:238113 61/248 (25%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060 75/290 (26%)
Tryp_SPc 232..462 CDD:238113 63/253 (25%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.