DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:303 Identity:83/303 - (27%)
Similarity:122/303 - (40%) Gaps:80/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITD 78
            :.::.::|...|...:..            ||:.|:.....|..::|.:.|.|....|||:||..
Zfish     8 LCVLLEILAVSCQDVIQA------------RIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINK 60

  Fly    79 KLVLTAAHCFI--ANQHLVARLGEYERTRSEECTGYY---CNFREEHMVDAGFKHKLYDPNTHAN 138
            ..|||||||.|  ||..:||  |:|.       .|.|   ..||..||:   ..|..||.:|:..
Zfish    61 YWVLTAAHCNIGEANMRIVA--GDYS-------VGLYEGMEQFRRPHML---IPHPQYDRSTNNA 113

  Fly   139 DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKID------------LLTATGWG-KTQMESDS 190
            ||.:::| :|.||.::              |:..:.            |.:.:||| .|.....|
Zfish   114 DIMLIKL-QSPVYLNS--------------YVSLVPLPRQDAMVAVGRLCSVSGWGFTTSTGGIS 163

  Fly   191 DALQTLDIRRQPPDVC---AKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPL---GAVITHKNTQ 247
            ..|:|:.:......||   ..|.| .|..|..|||  ....:.|.|||||||   |.|       
Zfish   164 SILRTVKLPIVSTAVCNGTDSFNG-NITENMICAGYSTGGKDACKGDSGGPLVCEGRV------- 220

  Fly   248 RFVQVGIASYTN--RNCQKASVFTDVLSHAEFI-LRVWRMYGK 287
                .||.|:.|  .:.|...|:|.|....::| ..::..||:
Zfish   221 ----YGIVSWGNGCADAQYPGVYTAVSQFRQWIDATIFGFYGR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/261 (30%)
Tryp_SPc 45..278 CDD:238113 77/260 (30%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 78/261 (30%)
Tryp_SPc 27..252 CDD:238113 78/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.