DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and KLK15

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:277 Identity:73/277 - (26%)
Similarity:107/277 - (38%) Gaps:76/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEY 101
            |.::...:::.|.....:|.||.|.|:. ...|.||.|||:...||:||||  .::.:..||||:
Human    14 TAAQDGDKLLEGDECAPHSQPWQVALYE-RGRFNCGASLISPHWVLSAAHC--QSRFMRVRLGEH 75

  Fly   102 ---ERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRP------ 157
               :|...|:       .|....|   ..|..|:..:|.|||.:|||.:.......:||      
Human    76 NLRKRDGPEQ-------LRTTSRV---IPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTR 130

  Fly   158 ------ICVVWDHRWRHYLDKIDLLTATGWG-------------KTQMESDSDALQTLDIRRQPP 203
                  .|||                 :|||             ::|: |..|.|...:|.....
Human   131 CPHPGEACVV-----------------SGWGLVSHNEPGTAGSPRSQV-SLPDTLHCANISIISD 177

  Fly   204 DVCAKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPL--GAVITHKNTQRFVQVGIASYTNRNCQ- 263
            ..|.|.....:.....|||  ...:..|.|||||||  |.::.          ||.|:.:..|. 
Human   178 TSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQ----------GIVSWGDVPCDN 232

  Fly   264 --KASVFTDVLSHAEFI 278
              |..|:|.|..:.|:|
Human   233 TTKPGVYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/268 (26%)
Tryp_SPc 45..278 CDD:238113 71/267 (27%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 71/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.