DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and zgc:112038

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:287 Identity:87/287 - (30%)
Similarity:121/287 - (42%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHS-TTDMFVCGGS 74
            :||..|:..:..:.|.  || .||....:...    .|..|...|.||...:|. :.:..:||||
Zfish     8 YVGEFLLLNIAGALCQ--LD-VCGQAPLNNNN----GGDDAVAGSWPWQASIHRISPEDHICGGS 65

  Fly    75 LITDKLVLTAAHCFI--ANQHLVARLGEYERTRSEECTGYYCNFRE-EHMVDAGFKHKLYDPNTH 136
            ||....||:|||||:  |..::...||...:|.|        |..| ...:.....|..|...|.
Zfish    66 LINKDWVLSAAHCFMITATANIKIFLGRQFQTGS--------NPNEISRTLTQIVIHPDYSTTTQ 122

  Fly   137 ANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTA-------TGWGKTQMESD---SD 191
            .||||:||||.||.:.|.|||:|          |...|.:.|       |||.| ...||   ::
Zfish   123 NNDIALLRLSSSVTFTDYIRPVC----------LASADSVFAGGTKSWITGWDK-HRSSDIQVTN 176

  Fly   192 ALQTLDIRRQPPDVCAKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
            .||.:.:.......|.......|..|..|||  ....:.|.||||||:    ..:|..|::|.||
Zfish   177 VLQEVQLPVVSNTECNADYKGIITDNMICAGINEGGKDACQGDSGGPM----VSQNGSRWIQSGI 237

  Fly   255 ASYTNRNC---QKASVFTDVLSHAEFI 278
            .|: .|.|   :...::|.|..:..:|
Zfish   238 VSF-GRECGLPRYPGIYTRVSQYQSWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/252 (31%)
Tryp_SPc 45..278 CDD:238113 78/251 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 78/249 (31%)
Tryp_SPc 37..263 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.