DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and f2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001015797.1 Gene:f2 / 548514 XenbaseID:XB-GENE-481539 Length:607 Species:Xenopus tropicalis


Alignment Length:298 Identity:79/298 - (26%)
Similarity:129/298 - (43%) Gaps:65/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPACGIR----------------TQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM-FVCGGSLIT 77
            :..||:|                .:|....||:.|.||:..|:||.|.|...:.. .:||.||::
 Frog   319 EAVCGLRPLFEQKSVEDKGEKELLESYMQGRIVKGETAEPGSAPWQVMLFKKSPQELLCGASLLS 383

  Fly    78 DKLVLTAAHCFI--------ANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPN 134
            |:.||:||||..        ....::.|:|::.||:.|..|......  |.::    .|..|:..
 Frog   384 DRWVLSAAHCIFYPPWDKNYTTDDILVRIGKHFRTKYERATERIAQL--ERII----VHPKYNWK 442

  Fly   135 THAN-DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTA------TGWGKTQ------M 186
            .:.: |||:::|.:.|.:.:.|.|:|:....      ..:.||.|      ||||..|      .
 Frog   443 ENLDRDIALIQLKRPVAFSNYIHPVCLPTKD------TVVKLLAAGYKGRVTGWGNLQETWTSGA 501

  Fly   187 ESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAG-----NWDSNLCNGDSGGPLGAVITHKNT 246
            ::...|||.:::.....:.|.......:..|.||||     :...:.|.||||||.  |:...:|
 Frog   502 QNLPQALQQINLPIVDQETCKSSTNIKVTDNMFCAGYNPEDSKRGDACEGDSGGPF--VMKDPDT 564

  Fly   247 QRFVQVGIASYTNRNCQKASVFTDVLSHAEFILRVWRM 284
            .|:||:||.|: ...|.:.:.:       .|.:.|.||
 Frog   565 GRWVQLGIVSW-GEGCDRDNKY-------GFYVHVHRM 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/260 (27%)
Tryp_SPc 45..278 CDD:238113 70/259 (27%)
f2NP_001015797.1 GLA 23..86 CDD:214503
KR 106..185 CDD:214527
KR 206..287 CDD:214527
Thrombin_light 303..349 CDD:370463 4/29 (14%)
Tryp_SPc 349..598 CDD:214473 75/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.