DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Mcpt4

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_062194.1 Gene:Mcpt4 / 54270 RGDID:3064 Length:246 Species:Rattus norvegicus


Alignment Length:298 Identity:76/298 - (25%)
Similarity:116/298 - (38%) Gaps:86/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTD---MFVCGGSL 75
            :.||..||.||..               |..||.|..:..:|.|:|..|...|:   :..|||.|
  Rat     5 LFLMALLLPSGAG---------------AEEIIGGVESIPHSRPYMALLKIVTEEGHVTFCGGFL 54

  Fly    76 ITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDI 140
            |:.:.|||||||.  .:.:...||.::.::.|...      ::..:|...|..| |:..::..||
  Rat    55 ISLQFVLTAAHCH--GREITVTLGAHDMSKRESTQ------QKIKVVKQIFPLK-YNLFSNFRDI 110

  Fly   141 AILRLSKSVVY------------RDNIRP--ICVVWDHRWRHYLDKIDLLTATGWGKTQM-ESDS 190
            .:|:|.:..|.            .|.|:|  :|:                 |.|||:|.: |.:|
  Rat   111 MLLKLEQKAVLTPSVNVIPLPQSSDIIKPGTMCL-----------------AAGWGQTGVKEPNS 158

  Fly   191 DALQTLDIRRQPPDVCA-------KFIGQTIAGNQFCAG--NWDSNLCNGDSGGPL-GAVITHKN 245
            :.|:.:.:|......|.       :|        |.|.|  ........||||||| .|.:.|  
  Rat   159 NTLREVMLRIMEMKACKDYRHYDNRF--------QICVGIPQMLKLAYKGDSGGPLVCAGVAH-- 213

  Fly   246 TQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILRVWR 283
                   ||.|:.........:||.:.|:..:|.||.|
  Rat   214 -------GIVSHGPGRGIPPIIFTRISSYVSWINRVIR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/261 (25%)
Tryp_SPc 45..278 CDD:238113 65/260 (25%)
Mcpt4NP_062194.1 Tryp_SPc 20..239 CDD:214473 65/261 (25%)
Tryp_SPc 21..242 CDD:238113 66/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.