DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Mcpt10

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_058842.2 Gene:Mcpt10 / 54269 RGDID:3063 Length:248 Species:Rattus norvegicus


Alignment Length:253 Identity:68/253 - (26%)
Similarity:103/253 - (40%) Gaps:42/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWM---VFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            ||.|..:|.:|.|:|   :|.:..:....|||.|:...:|:|||||..:|  :...||.:...: 
  Rat    21 IIWGTESKPHSRPYMASLMFYYGNSYRHYCGGFLVAKDIVMTAAHCNGSN--IKVTLGAHNIKK- 82

  Fly   107 EECTGYYCNFREEHMVDAGFK---HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRH 168
                      :|:..|.|..|   |:.||.::..|||.:|:|.:.......::.|.:.....|  
  Rat    83 ----------QEKTQVIAVVKAKPHENYDRHSRFNDIMLLKLERKAQLNGAVKTIALPRSQDW-- 135

  Fly   169 YLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLC--NG 231
             :....:.|..|||.....|.|:.||.:::..|....|...........|.|.||......  .|
  Rat   136 -VKPGQVCTVAGWGCLANCSLSNTLQEVNLEVQEGQKCEDMSRNYNDSIQLCVGNPSEGKATGKG 199

  Fly   232 DSGGPL---GAVITHKNTQRFVQVGIASYTNRNCQKA--SVFTDVLSHAEFILRVWRM 284
            |||||.   |           |..||.||  |.|...  .|||.:.|...:|.:..::
  Rat   200 DSGGPFVCDG-----------VAQGIVSY--RLCTGTLPRVFTRISSFIPWIQKTMKL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/245 (27%)
Tryp_SPc 45..278 CDD:238113 67/245 (27%)
Mcpt10NP_058842.2 Tryp_SPc 21..241 CDD:238113 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.