DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Cfd

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:260 Identity:65/260 - (25%)
Similarity:107/260 - (41%) Gaps:54/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLV-ARLGEYERTR 105
            ||:.|..|..::.|:|..: ......||||:|:.::.||:||||.  :....:| ..||.:..:.
  Rat    25 RILGGQEAMAHARPYMASV-QVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSS 88

  Fly   106 SEECTGYYCNFREEHMVDAGFKHKLYD-----------PNTHANDIAILRLSKSVVYRDNIRPIC 159
            .|.                 :|| |||           |::..:|:.:.:||.:.....::||:.
  Rat    89 PEP-----------------YKH-LYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLP 135

  Fly   160 VVWDHRWRHYLDKIDLLTATGWG-KTQMESDSDALQTLDIRRQPPDVC--AKFIGQTIAGNQFCA 221
            :..:.|   .:....|....||| .|......|.||.|.:.....:.|  ..:....|..|..||
  Rat   136 LQREDR---EVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCA 197

  Fly   222 GNWDSNLCNGDSGGPL--GAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFILRV 281
            .:...:.|.|||||||  |..:.          .:.::.:|.|   :|..|||.|.::..:|..|
  Rat   198 ESNRRDTCRGDSGGPLVCGDAVE----------AVVTWGSRVCGNRRKPGVFTRVATYVPWIENV 252

  Fly   282  281
              Rat   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 63/255 (25%)
Tryp_SPc 45..278 CDD:238113 62/254 (24%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 63/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.