DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and prss60.2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:265 Identity:86/265 - (32%)
Similarity:117/265 - (44%) Gaps:44/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTT-DMFVCGGSLITDKLVLTAAHCF--IANQHL 94
            ||   |:....||:.|..|...|.||.|.|.|.. ....||||||:.:.|||||||.  ::...|
Zfish    25 CG---QAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFCGGSLISSEWVLTAAHCLPGVSESSL 86

  Fly    95 VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPIC 159
            |..||.    |:::....:...|....:   ..|..|:.||:.||||:||||.:|.:.|.|||:|
Zfish    87 VVYLGR----RTQQGVNTHETSRNVAKI---IVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVC 144

  Fly   160 VVWDH--------RWRHYLDKIDLLTATGWGKTQMESDSDA---LQTLDIRRQPPDVCAKFIGQ- 212
            :...:        .|           .||||..|...:..|   ||...|.....|.|...:|. 
Zfish   145 LAAQNSVYSAGTSSW-----------ITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQLGSG 198

  Fly   213 TIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIAS--YTNRNCQKASVFTDVLS 273
            |:..|..|||  ....:.|.||||||:   :|...|. ::|.||.|  |...:.....|:|.|..
Zfish   199 TVTNNMICAGLAKGGKDTCQGDSGGPM---VTRLCTV-WIQAGITSWGYGCADPNSPGVYTRVSQ 259

  Fly   274 HAEFI 278
            :..:|
Zfish   260 YQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 82/252 (33%)
Tryp_SPc 45..278 CDD:238113 81/251 (32%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 82/252 (33%)
Tryp_SPc 34..267 CDD:238113 82/253 (32%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.