DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gzmbl1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_038949997.1 Gene:Gzmbl1 / 502004 RGDID:1561819 Length:277 Species:Rattus norvegicus


Alignment Length:308 Identity:82/308 - (26%)
Similarity:117/308 - (37%) Gaps:84/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH---STT 66
            |.|:|..:.::|:          .|..:...|||   |..||.||.|..||.|:|.:|.   ..:
  Rat    23 LSGLPGKMKLLLL----------LLTFSLAPRTQ---AGEIIGGHEANPNSRPYMAYLQIMDKDS 74

  Fly    67 DMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHM------VDAG 125
            ....|||.||....|||||||.  ...::..||.:             |.:|:..      |...
  Rat    75 GNKTCGGFLIRKDFVLTAAHCL--GSKIIVTLGAH-------------NIKEQEKKQQVIPVVKI 124

  Fly   126 FKHKLYDPNTHANDIAILRLSKSV----------VYRDN--IRP--ICVVWDHRWRHYLDKIDLL 176
            ..|..|:..|.:|||.:|:|....          :.|.|  ::|  :|.|               
  Rat   125 IPHPAYNAKTISNDIMLLKLKSKAKRTSAVKTLNLPRSNFKVKPGDVCYV--------------- 174

  Fly   177 TATGWGKT-QMESDSDALQTLDIRRQPPDVCAKFIGQTI-AGNQFCAGNWDSNL----CNGDSGG 235
              .||||. .|....|.||.:::..|....|...:.... ..|:.|||  |.|:    ..|||||
  Rat   175 --AGWGKLGPMGEFPDTLQEVELTVQEDQKCESHLTNVYDKANEICAG--DPNIKRASFQGDSGG 235

  Fly   236 PLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILRVWR 283
            ||   :..|     |..||.||..::......||.|.:...:|.:..:
  Rat   236 PL---VCKK-----VAAGIVSYGRKDGSTPREFTKVSTFLSWIKKTMK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/262 (27%)
Tryp_SPc 45..278 CDD:238113 72/261 (28%)
Gzmbl1XP_038949997.1 Tryp_SPc 50..273 CDD:238113 73/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.