DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss33

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:293 Identity:74/293 - (25%)
Similarity:109/293 - (37%) Gaps:91/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF----IANQ 92
            |||   |.|.:.||:.|..|:....||...:.. ....|||||||..:.||||.|||    :.::
  Rat    24 ACG---QPRMSSRIVGGRDAQDGEWPWQTSIQH-RGAHVCGGSLIAPQWVLTAGHCFSRRVLPSE 84

  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL------------YDPNTHANDIAILRL 145
            :.|. ||...                   :|....|:|            |..:....|:|:|:|
  Rat    85 YSVL-LGALS-------------------LDVTSSHELLVPVLRVLLPPDYSEDEARGDLALLQL 129

  Fly   146 SKSVVYRDNIRPICV------------VWDHRWRHYLDKIDLLTATGWGKTQME---SDSDALQT 195
            |..|.....|:|:|:            .|               .||||.....   .....||.
  Rat   130 SHPVSLSARIQPVCLPAPGSHPPPGSPCW---------------VTGWGSLSPGVPLPKGRPLQG 179

  Fly   196 LDIRRQPPDVCAKF--IGQTI--------AGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQR 248
            :.:.......|.:.  :|..:        .|| .|||  ....:.|.|||||||    |...:.|
  Rat   180 VRVPLLDSRACDRLYHMGANVPKSERIVLPGN-LCAGYRRGHKDACQGDSGGPL----TCMESGR 239

  Fly   249 FVQVGIASYTNRNC---QKASVFTDVLSHAEFI 278
            :|.||:.|: .:.|   .:..|:|:|..::.:|
  Rat   240 WVLVGVVSW-GKGCALPNRPGVYTNVAKYSPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/279 (24%)
Tryp_SPc 45..278 CDD:238113 67/278 (24%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 68/279 (24%)
Tryp_SPc 34..272 CDD:238113 68/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.