DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and proz

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001116189.1 Gene:proz / 496781 XenbaseID:XB-GENE-971425 Length:416 Species:Xenopus tropicalis


Alignment Length:304 Identity:62/304 - (20%)
Similarity:110/304 - (36%) Gaps:100/304 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LHSGCSQFLDP------------------------------ACGIRTQSRTAYRIINGHTA---- 51
            :..||..|..|                              |||         :|:|...:    
 Frog   133 MEDGCQHFCHPSYEADSYSCSCANGYKLGADEKSCHPEDPFACG---------QILNLEVSITKN 188

  Fly    52 ----KYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF--------IANQHLVARLGEYERT 104
                :.:..||.|.:.::..:.||.|.::::.:|||.|.|.        :|.....:.||:.:..
 Frog   189 RNHLQADIFPWQVPVLNSQKVQVCSGVVLSESVVLTTASCITMYDPYFVVAGVQQKSGLGQRQMI 253

  Fly   105 RSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHY 169
            |.:.        ::.||        .|...|..|:||:|:|.:.:|:.:|..|||:.......:.
 Frog   254 RVKT--------KQVHM--------RYSEETGDNNIALLKLKEKIVFHNNSLPICIPQKDFAENV 302

  Fly   170 LDKIDLLTATGWGKTQMESDSDALQTLDIRRQ---PPDVCAKFIGQTIAGNQFCAGNW---DSNL 228
            |...:....:|| |:..|.::|||..:....:   ..:||.:.:..|.....||..:.   ||.|
 Frog   303 LVPFNTGLVSGW-KSSSEEEADALIPIQFYTKYTNRTEVCEQSLNVTQTNRMFCGVSHEAIDSEL 366

  Fly   229 CNGDS-----------GGPLGA---VITHKNTQRFVQVGIASYT 258
            ..|..           ||.:|:   .:.:|        |:.|:|
 Frog   367 SEGGHLAVQHNGVWFLGGIMGSWQPTLLNK--------GVFSFT 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 55/251 (22%)
Tryp_SPc 45..278 CDD:238113 55/250 (22%)
prozNP_001116189.1 GLA 22..85 CDD:214503
EGF_CA 92..123 CDD:238011
FXa_inhibition 136..167 CDD:373209 4/30 (13%)
Tryp_SPc 197..414 CDD:389826 53/231 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.