DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and betaTry

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster


Alignment Length:256 Identity:69/256 - (26%)
Similarity:107/256 - (41%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFL-----HSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLVARLGEY 101
            ||:.|.....:|.||.:.|     ||      ||||:.:.::::|||||.  ::...|..|.|  
  Fly    30 RIVGGTATTISSFPWQISLQRSGSHS------CGGSIYSARVIVTAAHCLQSVSASSLQIRAG-- 86

  Fly   102 ERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRW 166
                    :.|:.:......|.:...|:.|:.||..||||:|.||.|:.:...|:.|.:...:..
  Fly    87 --------SSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLASSNPA 143

  Fly   167 RHYLDKIDLLTATGWGKTQMESDS--DALQTLDIRRQPPDVCAKF---IGQTIAGNQFCAGNWDS 226
            ......:     :|||.....|.|  ..|:.:::.......|:..   .|..|..:..||.....
  Fly   144 NGAAASV-----SGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICAFASGK 203

  Fly   227 NLCNGDSGGPL--GAVITHKNTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFILRVW 282
            :.|.|||||||  |.|:          ||:.|: ...|..|:   |:.||.:     ||.|
  Fly   204 DSCQGDSGGPLVSGGVL----------VGVVSW-GYGCAAANYPGVYADVAA-----LRSW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/250 (26%)
Tryp_SPc 45..278 CDD:238113 65/249 (26%)
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 69/256 (27%)
Tryp_SPc 31..252 CDD:238113 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
11.000

Return to query results.
Submit another query.