DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012504

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001231011.2 Gene:AgaP_AGAP012504 / 4578496 VectorBaseID:AGAP012504 Length:839 Species:Anopheles gambiae


Alignment Length:285 Identity:76/285 - (26%)
Similarity:128/285 - (44%) Gaps:58/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRT-AYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHL 94
            ||.|.....|. |:....|.|.:..|..|:           ||||||.:..:||||||...:.::
Mosquito    19 PAAGSPAYLREFAHIAAIGWTNEDQSVRWL-----------CGGSLIWENFILTAAHCAADDDNV 72

  Fly    95 ---VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
               |||:|:......|:     ..|.::..:....:|..:..|::..|||:::|.::|...|.:.
Mosquito    73 PPDVARMGDINIYSDED-----DEFAQQLKIVEIIRHPKHKYNSNYYDIALMKLERNVTLHDTVA 132

  Fly   157 PICVVWDHRWRHYLDKIDL--LTATGWGKTQMESDSDALQT-LDIRRQP--PDVCA-------KF 209
            |.|:..|       |:|..  |.|.|||:|..  |.:..:| |.::..|  .|.|:       :.
Mosquito   133 PSCLWLD-------DEIRFPELLAAGWGRTGF--DQNTTKTLLKVQLAPITNDKCSTHYQRGVRK 188

  Fly   210 IGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQ-------VGIASYTNRNCQKAS- 266
            :...:..:|||||:...:.|.|||||||       :.:.|.:       ||:.|: .:.|..|: 
Mosquito   189 LENGLMDHQFCAGDEKMDTCPGDSGGPL-------HVKLFKEWKLIPFLVGVTSF-GKACGLAAP 245

  Fly   267 -VFTDVLSHAEFILRVWRMYGKGQT 290
             |:..|....::|:...:.:|:..|
Mosquito   246 GVYVKVSKFGDWIIETLQRHGEMAT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/257 (26%)
Tryp_SPc 45..278 CDD:238113 68/256 (27%)
AgaP_AGAP012504XP_001231011.2 Tryp_SPc 22..261 CDD:238113 72/271 (27%)
Tryp_SPc 22..258 CDD:214473 71/268 (26%)
Trypsin 327..528 CDD:278516
Tryp_SPc 333..>433 CDD:304450
Tryp_SPc 611..836 CDD:304450
Tryp_SPc 611..832 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.