DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP012502

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001230484.2 Gene:AgaP_AGAP012502 / 4578454 VectorBaseID:AGAP012502 Length:829 Species:Anopheles gambiae


Alignment Length:237 Identity:60/237 - (25%)
Similarity:99/237 - (41%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSLITDKLVLTAAHCFIANQHL----VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY 131
            ||||||....:||||||......|    :.|:|:.......|..     ..:|..:....:|.||
Mosquito    46 CGGSLIWANFILTAAHCTKDRDTLLPPDIIRIGDLNLYDDREDA-----LVQERTIIRVIRHPLY 105

  Fly   132 DPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL--LTATGWGKTQM-ESDSDAL 193
            :.::...|||:|.|::.|.....:.|.|:..|       |.|..  :.|.|||.:.. ...::.|
Mosquito   106 NTSSVFYDIALLMLNEKVNIYFEVMPTCLWLD-------DNIPFSKVEAAGWGTSGFGYGKTNIL 163

  Fly   194 QTLDIRRQPPDVCAKFIGQT------IAGNQFCAGNWDS--NLCNGDSGGPLGAVITHKNTQRFV 250
            ...:::......|..:..|.      :..:|.||  ||.  :.|.|||||||...:...:.:...
Mosquito   164 IKAELKLMANKDCESYYSQVASVKNGLMEHQLCA--WDKVMDTCPGDSGGPLQHKLIFGDYKVPF 226

  Fly   251 QVGIASYTNRNC--QKASVFTDVLSHAEFILRVWRMYGKGQT 290
            .||:.|: ..:|  .:..|:..|.....:|:...:.:|:..|
Mosquito   227 LVGVTSF-GLSCGNSQPGVYVKVSKFGSWIVETLQQHGERVT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 57/223 (26%)
Tryp_SPc 45..278 CDD:238113 57/223 (26%)
AgaP_AGAP012502XP_001230484.2 Tryp_SPc 19..258 CDD:238113 58/226 (26%)
Tryp_SPc 19..255 CDD:214473 57/223 (26%)
Tryp_SPc 325..>418 CDD:304450
Trypsin 621..823 CDD:278516
Tryp_SPc 629..826 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.