DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP009216

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001238238.1 Gene:AgaP_AGAP009216 / 4578289 VectorBaseID:AGAP009216 Length:244 Species:Anopheles gambiae


Alignment Length:248 Identity:67/248 - (27%)
Similarity:111/248 - (44%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGY-YCNFREEH 120
            ||...|.:::..|.|..|||:::.|||.||| |.|:::.     :.:.|.::|... .|....:.
Mosquito    17 PWTALLKTSSGEFACAASLISERYVLTVAHC-IKNRNVT-----FVQLRKKDCDEQGVCTLAPQD 75

  Fly   121 M-VDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV----VWDHRWRHYLD--------- 171
            : |:....|..:......||||::||:::|.:.:::.|||:    .:.....:|..         
Mosquito    76 IPVERAIAHDGFSARRKLNDIALVRLAQNVSFNNDVLPICLPVAPEYQPAGSNYFTARDGQDYAS 140

  Fly   172 -KIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFC---AGNWDSNLCNGD 232
             ..|.::.|.......|:..:.||.| |:||          ..|..:..|   ||::|.  |...
Mosquito   141 LNTDTISITEVHPLTTENCENRLQEL-IKRQ----------HKIQESHICGYEAGSFDG--CATS 192

  Fly   233 SGGPLGAVITHKNTQRF---VQVGIASYTNRNC---QKASVFTDVLSHAEFIL 279
            :||||.|:      .||   ||.|:.||..::|   ...||:|.|.|...:||
Mosquito   193 AGGPLVAL------DRFGRNVQHGVVSYGVQDCSLENVPSVYTRVESFINWIL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/245 (27%)
Tryp_SPc 45..278 CDD:238113 65/245 (27%)
AgaP_AGAP009216XP_001238238.1 Tryp_SPc 14..238 CDD:214473 65/245 (27%)
Tryp_SPc 14..238 CDD:238113 65/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.