DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP009219

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001238240.1 Gene:AgaP_AGAP009219 / 4578286 VectorBaseID:AGAP009219 Length:120 Species:Anopheles gambiae


Alignment Length:116 Identity:39/116 - (33%)
Similarity:54/116 - (46%) Gaps:31/116 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCA---GNWDSNLCNG 231
            :.|:|::||        :...:.|..| :||:|          ||..:|.||   |..|:  |. 
Mosquito    25 ITKVDMVTA--------DQRQNRLNEL-VRRKP----------TIHESQICAFQSGGSDN--CE- 67

  Fly   232 DSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFIL 279
            :|.|||.|:   ....|.||.|||||...||   ...||:|.|.|..::||
Mosquito    68 NSLGPLTAL---GRNGRHVQYGIASYGVNNCDLDNSPSVYTRVESFIDWIL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 37/113 (33%)
Tryp_SPc 45..278 CDD:238113 37/113 (33%)
AgaP_AGAP009219XP_001238240.1 Tryp_SPc <41..117 CDD:304450 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.