DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP009218

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001238239.1 Gene:AgaP_AGAP009218 / 4578285 VectorBaseID:AGAP009218 Length:193 Species:Anopheles gambiae


Alignment Length:204 Identity:51/204 - (25%)
Similarity:92/204 - (45%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQL--LHSGCSQFLD-PACGIRTQSRTAYRIINGHTAKYNSS----PWMVFLHSTTDMFVCG 72
            ||:..|  .|...:..|| ..||:.       |:.|..|...|.:    ||:..:.|::...:||
Mosquito     6 ILLIALHGAHQATAHLLDLEGCGMN-------RMQNNETLGNNDNLGQLPWIASIKSSSGQHICG 63

  Fly    73 GSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA 137
            ||||:.:.|||||||...|.....:|.:.:...|..||    ..:|:..::....|..|:....:
Mosquito    64 GSLISKRYVLTAAHCLGHNDLAFVQLRKKDCDESGVCT----LAKEDIPIERTIGHDSYNKPVQS 124

  Fly   138 NDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGW-----GKTQMESDSDALQTLD 197
            :|||::||::...:..::||||:.....::        .||:.:     |:.....::|.::..:
Mosquito   125 HDIALVRLTRDASFNSDVRPICLPMGPEYQ--------TTASKYFVAPRGQDYASLNTDTIEITE 181

  Fly   198 IRRQPPDVC 206
            :.....|.|
Mosquito   182 VDLVTADQC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 43/172 (25%)
Tryp_SPc 45..278 CDD:238113 42/171 (25%)
AgaP_AGAP009218XP_001238239.1 Tryp_SPc 39..>193 CDD:304450 40/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.