DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPE7

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001238368.1 Gene:CLIPE7 / 4577639 VectorBaseID:AGAP011786 Length:433 Species:Anopheles gambiae


Alignment Length:285 Identity:70/285 - (24%)
Similarity:119/285 - (41%) Gaps:51/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSS--PWMVFL---HSTTDMF--VCGGS 74
            :|.|..|..|...:.:||.|          |.|...::::  ||:|.:   ....|.|  :||.|
Mosquito   160 VFSLDDSESSDSEEESCGTR----------NDHGIGFDATHFPWLVSVFHEEHAPDSFSLICGAS 214

  Fly    75 LITDKLVLTAAHCF--IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA 137
            |||...||||..|.  :..:.|:.|.||: .::.:|...|    :|..:.|. ..::.|:..|.:
Mosquito   215 LITPHAVLTAGRCVFNMPKEKLLLRAGEW-TSQDKELRQY----QERRVADI-MTYEEYNDRTFS 273

  Fly   138 NDIAILRLSKSVVYRDNIRPICV----VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDI 198
            |::|:|.|::......|::|||:    .....:|.:....|...:..:|..|:..:...:     
Mosquito   274 NNVALLNLTEPFQRTGNVQPICLPPIPASIDAYRCFTVAFDEHLSYKYGSVQLNVNMAHI----- 333

  Fly   199 RRQPPDVCAKFIGQTIAG--NQFCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR 260
                |.:...|...:..|  :..|| ||...|:|...:|.||...:. .:...:.|.||.|: ..
Mosquito   334 ----PVMLFGFCRHSGPGPSSYLCARGNLGPNVCRAITGTPLVCPMP-GSPNHYYQAGIVSW-GV 392

  Fly   261 NCQK---ASVFTDVLSHAEFILRVW 282
            .|..   .||:.:|.|     .|.|
Mosquito   393 GCDTYGVPSVYGNVAS-----FRYW 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 61/252 (24%)
Tryp_SPc 45..278 CDD:238113 61/251 (24%)
CLIPE7XP_001238368.1 Tryp_SPc 185..415 CDD:238113 61/250 (24%)
Tryp_SPc 185..413 CDD:214473 61/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.