DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP011040

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001237041.2 Gene:AgaP_AGAP011040 / 4577547 VectorBaseID:AGAP011040 Length:284 Species:Anopheles gambiae


Alignment Length:241 Identity:66/241 - (27%)
Similarity:98/241 - (40%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FVCGGSLITDKLVLTAAHCF----IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHK 129
            |.||||||.:..|||||||.    ...:.||.|||:.....|::     ..:.:|..:.....|.
Mosquito    47 FGCGGSLILESFVLTAAHCMDNPNTLERPLVVRLGDRNLIHSKD-----SEYAQEIKIRDIIPHP 106

  Fly   130 LYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESD----- 189
            .|:..|...|||:|.|.|.......:.|.|:     |.........|.|.|||....:..     
Mosquito   107 KYNRATSHFDIALLVLDKPARRVFGVIPACL-----WLEDELLFSTLYAAGWGANGFDKKPTNYL 166

  Fly   190 -SDALQTL-------DIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNT 246
             :..||.:       .::||.|.:   .:...|:.:|.||...:.:.|.|||||||.:.:...|.
Mosquito   167 VTAVLQPVTNEECIDKLKRQVPRM---KLANGISDHQLCAAGIEMDTCKGDSGGPLYSKLNFANK 228

  Fly   247 QRFVQVGIASYTNRNC--QKASVFTDVLSHAEFILRVWRMYGKGQT 290
            .....||:.|| ...|  .:..|:..|....::|:...|.:....|
Mosquito   229 LVPFLVGLTSY-GGPCGFSQPGVYVRVSKFRDWIIETIRQFNPSVT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 63/227 (28%)
Tryp_SPc 45..278 CDD:238113 63/227 (28%)
AgaP_AGAP011040XP_001237041.2 Tryp_SPc 49..264 CDD:238113 63/228 (28%)
Tryp_SPc 49..261 CDD:214473 62/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.