DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPA19

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001237509.2 Gene:CLIPA19 / 4577382 VectorBaseID:AGAP003245 Length:356 Species:Anopheles gambiae


Alignment Length:271 Identity:73/271 - (26%)
Similarity:117/271 - (43%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH----STTDMFVCGGSLITDKLVLTAAHCFIA- 90
            |.||:    |.|.::......:.:..||...:.    ..|..|.|||:||....:||||||..: 
Mosquito    94 PHCGV----RAATQLTGAQLTQPDDYPWTALIEYEKPDGTTGFHCGGTLINQGHILTAAHCVSSL 154

  Fly    91 ----NQHLVARLGEYERTRSEECTGYYCNFRE-EHMVDAGFKHKLYDPNTHA--NDIAILRLSKS 148
                ..|.|. |||::.:...:|....||... |..|.....|..||....:  :|||::|..:.
Mosquito   155 RAGWKVHRVL-LGEWDLSSVLDCAYNVCNNPPIEAKVSKIIVHDGYDAQNGSFNHDIALIRFEEL 218

  Fly   149 VVYRDNIRPICV-VWDH-RWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFI- 210
            ..:.|.|.|||: :.|. .|.:..|...  |..||||:|..:.......|:::.:....|:..: 
Mosquito   219 ANFPDTIVPICLPIADSIPWENITDGFS--TVVGWGKSQSTAGVTKKLKLNLKVRNFRECSSLLE 281

  Fly   211 -GQTIAGNQFCAGNWD-SN--LCNGDSGGPLGAVITHKNTQRF-VQVGIASYTNRNCQKA---SV 267
             .:.:..:|.|| .|: ||  :|:.|:||.|....     :|| ..:|:|....:.|...   .|
Mosquito   282 WPEKMQPSQLCA-LWERSNRKICSADAGGGLAWFY-----RRFHYLIGVAGSDEQKCGSGDVPGV 340

  Fly   268 FTDVLSHAEFI 278
            |.:|..:..:|
Mosquito   341 FVNVSYYMNWI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/256 (26%)
Tryp_SPc 45..278 CDD:238113 67/255 (26%)
CLIPA19XP_001237509.2 CLIP 37..84 CDD:197829
Tryp_SPc 106..354 CDD:238113 68/255 (27%)
Tryp_SPc 106..351 CDD:214473 67/253 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.