DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPB19

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001237510.1 Gene:CLIPB19 / 4577378 VectorBaseID:AGAP003247 Length:367 Species:Anopheles gambiae


Alignment Length:279 Identity:83/279 - (29%)
Similarity:125/279 - (44%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH------STTDMFVCGGSLITDKLVLTAAHCFI 89
            |.||:||.:    |:|.....:.:..||...:.      ||.  |.|||:||....:||||||..
Mosquito   104 PHCGVRTNT----RLIGSQFTQLDDYPWTALIEYEKPDGSTG--FHCGGTLINQGHILTAAHCVS 162

  Fly    90 A-----NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFK----HKLYDP--NTHANDIAIL 143
            .     ..|.| ||||::.:.:.:|...|||   ...||....    |:.||.  .:.::|||::
Mosquito   163 TLPAGWKVHGV-RLGEWDLSEALDCELNYCN---NAPVDLKISKIMIHEGYDALNGSSSHDIALI 223

  Fly   144 RLSKSVVYRDNIRPIC--VVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVC 206
            |..:.|.:.|.|:|||  :....|.::..|.|.  |..||||:|..:.......|::..:...||
Mosquito   224 RFEQQVNFSDTIKPICLPLAESIRSKNMTDGIS--TVVGWGKSQSSAGVPKRLKLNLNVRDYRVC 286

  Fly   207 -AKFI-GQTIAGNQFCAGNWDSN--LCNGDSGGPLGAVITHKNTQRFVQ-----VGIASYTNRNC 262
             |.|: .:.:..:|.||...:||  ||:.|||..|         :||..     .|||......|
Mosquito   287 SALFVRPEEVQPSQLCALREESNNELCSADSGAGL---------ERFFYGFQYLTGIAGSGEHKC 342

  Fly   263 QKASV---FTDVLSHAEFI 278
            .:.::   |..|..:.|:|
Mosquito   343 GRGNIPGLFVSVADYVEWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/264 (29%)
Tryp_SPc 45..278 CDD:238113 76/263 (29%)
CLIPB19XP_001237510.1 CLIP 36..89 CDD:288855
Tryp_SPc 113..361 CDD:214473 77/264 (29%)
Tryp_SPc 115..364 CDD:238113 77/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.