DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP004569

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001237553.3 Gene:AgaP_AGAP004569 / 4577070 VectorBaseID:AGAP004569 Length:296 Species:Anopheles gambiae


Alignment Length:275 Identity:73/275 - (26%)
Similarity:128/275 - (46%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SQFLDPACGI--RTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC- 87
            |:..|..||:  ||.     ||:.|..|..:..||:..|.....:: ||.|:::...::||||| 
Mosquito    35 SESCDCVCGVGGRTN-----RIVGGSEAAAHQFPWLAGLFRQGKLY-CGASVVSRNFLVTAAHCV 93

  Fly    88 --FIANQ-------HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAIL 143
              |.|::       |.:|:  :|...|           |.:.::|    |:.:|..|..||||:|
Mosquito    94 NSFEASEIRVYLGGHNIAK--DYTELR-----------RVKRIID----HEDFDIFTFNNDIALL 141

  Fly   144 RLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKT-QMESDSDALQTLDIRRQPPDVC- 206
            .|.|.:.|...|:|.|:. |.....:...|.::  .|||:. :..:.|..|:::::.....:.| 
Mosquito   142 ELDKPLRYGPTIQPACLP-DGSVMDFTGTIGVV--AGWGRVEEKRAPSKTLRSVEVPIWSQEQCL 203

  Fly   207 -AKFIGQTIAGNQFCAGNWD--SNLCNGDSGGPLGAVITHKN--TQRFVQVGIASYTNRNCQKAS 266
             |.:..:.|:.|..|||..|  .:.|.||||||:     ||.  ......:|:.|: .|.|.:.:
Mosquito   204 DAGYGSKKISANMMCAGYHDGQKDACQGDSGGPM-----HKMGLFGSMEVIGVVSW-GRGCARPN 262

  Fly   267 ---VFTDVLSHAEFI 278
               ::|.::::..:|
Mosquito   263 LPGIYTRIVNYLPWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/253 (26%)
Tryp_SPc 45..278 CDD:238113 65/252 (26%)
AgaP_AGAP004569XP_001237553.3 Tryp_SPc 50..277 CDD:214473 66/253 (26%)
Tryp_SPc 51..280 CDD:238113 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.