DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:208 Identity:64/208 - (30%)
Similarity:96/208 - (46%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ--HLVARLGEYERTRS 106
            |::.|..||..|:|:.|.|........|||||:.::.|||||||.:..:  .|:..:|    |.|
Mosquito    32 RVVGGEVAKNGSAPYQVSLQVPGWGHNCGGSLLNNRWVLTAAHCLVGYEPSDLMVLVG----TNS 92

  Fly   107 EECTGYYCNFREEHMVDAGFKHKLYD-PNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYL 170
            .:..|      |...||....|..|: |..| |||.::||.:.|.:.:.::.:         .||
Mosquito    93 LKEGG------ELLKVDKLLYHSRYNRPQFH-NDIGLMRLEQPVQFSELVQSV---------EYL 141

  Fly   171 DKIDLLTA----TGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIG--QTIAGNQFC----AGNW 224
            :|...:.|    ||||:|....: ...||:|::.....:.|...:|  :.:.....|    ||  
Mosquito   142 EKAVPVNATVRLTGWGRTSTNGNVPTLLQSLNVVTLSNEDCKAKMGNPENVDLGHVCTLTKAG-- 204

  Fly   225 DSNLCNGDSGGPL 237
             ...|||||||||
Mosquito   205 -EGACNGDSGGPL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/208 (31%)
Tryp_SPc 45..278 CDD:238113 63/207 (30%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 64/208 (31%)
Tryp_SPc 33..253 CDD:238113 63/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.