DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP004740

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_001231095.2 Gene:AgaP_AGAP004740 / 4576567 VectorBaseID:AGAP004740 Length:258 Species:Anopheles gambiae


Alignment Length:242 Identity:68/242 - (28%)
Similarity:107/242 - (44%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTA---KYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTR 105
            ||:||..|   .||:  ::::|:|....|..|||||:|:.|||||       ..:|....:|...
Mosquito    29 RIVNGLNAANTPYNA--YVLYLNSANSGFFGGGSLISDRHVLTAA-------QNIAGFVRWEVGL 84

  Fly   106 SEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYL 170
            .....| ..|.:......|   |..::....||||..:.|.:.:|:...|.||.:....|...|.
Mosquito    85 GSTVFG-QLNIQISSQAVA---HPSFNMANRANDIGFIVLPQPIVFTALISPIQLPIQGRNLPYE 145

  Fly   171 DKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGN--WDSNLCNGDS 233
            ::..::...|:.....:..||.|: :..:|...|.....|.|....|.|||.:  ..||:||||.
Mosquito   146 NEEGMIVGFGFNSVGGQVRSDFLK-VGYQRVISDSRCVGIYQITLPNHFCAEDSVMRSNVCNGDL 209

  Fly   234 GGPLGAVITHKNTQRFVQVGIASYTNRNCQKASV--FTDVLSHAEFI 278
            |.  |.|::.:.....  ||:||....:|...|.  :|.|..:.::|
Mosquito   210 GA--GFVVSDRRIDTL--VGVASLITASCDSTSPTGYTRVSQYRQWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/240 (28%)
Tryp_SPc 45..278 CDD:238113 66/239 (28%)
AgaP_AGAP004740XP_001231095.2 Tryp_SPc 29..252 CDD:214473 67/240 (28%)
Tryp_SPc 30..255 CDD:238113 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.